PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG268500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CO-like
Protein Properties Length: 363aa    MW: 38426.2 Da    PI: 6.4397
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG268500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.26.1e-075499342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          ++C+ +e  ++   C+ +   lC+ C   +H        H +vp+
  Pavir.4NG268500.1.p 54 VWMCEVCELAPAAVTCKADAAVLCAACDADIHDAnplarrHARVPV 99
                         689*****************************44677777888775 PP

2CCT70.44.6e-24288331144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  Pavir.4NG268500.1.p 288 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRA 331
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.32951IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3525299IPR000315B-box-type zinc finger
SMARTSM003364.1E-135299IPR000315B-box-type zinc finger
CDDcd000211.90E-75599No hitNo description
PROSITE profilePS5101716.896288330IPR010402CCT domain
PfamPF062038.2E-18288330IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MELHKYWGVG GRRCGGCEAA PAAVHCRSCP AGGAFLCTAC DARPGHARLG HERVWMCEVC  60
ELAPAAVTCK ADAAVLCAAC DADIHDANPL ARRHARVPVA PIGSEAAAAA VEAMLFGTGE  120
PAASEAEEPQ NAAAGHNHQH ALNLNVEAKD MKLDYLFSDL DPYLSVDIPR FQHADSVVPS  180
GVGAGAAGTV ELDFTCGIGV KPSSYSSYTA TSLAHSGSSS EVGVVPEAFC GGGGSFELDF  240
TRPKPQAYMP YTATPQSHSV SSVDVEVVPE RGDMMAAARP VPLVGESREA RLMRYREKRK  300
NRRFEKTIRY ASRKAYAETR PRIKGRFAKR ADHDADDAEA EAAVPSPASY VLDFGYGVVP  360
SF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.6090.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9581260.0EU958126.1 Zea mays clone 1674443 CONSTANS-like protein CO6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148229.10.0CONSTANS-like protein CO6
TrEMBLB6SZG10.0B6SZG1_MAIZE; CONSTANS-like protein CO6
STRINGGRMZM2G038783_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-41CONSTANS-like 5